Class a: All alpha proteins [46456] (289 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
Protein automated matches [226859] (32 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [224993] (2 PDB entries) |
Domain d1xrea1: 1xre A:3-92 [203155] Other proteins in same PDB: d1xrea2, d1xreb2 automated match to d1jr9a1 complexed with mn |
PDB Entry: 1xre (more details), 1.8 Å
SCOPe Domain Sequences for d1xrea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xrea1 a.2.11.0 (A:3-92) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} sfqlpklsydydelepyidsntlsihhgkhhatyvnnlnaalenyselhnksleellcnl etlpkeivtavrnnggghychslfwevmsp
Timeline for d1xrea1: