Lineage for d1bfof1 (1bfo F:1-121)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102281Species CAMPATH-1G igg2b monoclonal fab (rat), kappa L chain [48867] (1 PDB entry)
  8. 102287Domain d1bfof1: 1bfo F:1-121 [20315]
    Other proteins in same PDB: d1bfoa2, d1bfob2, d1bfoc2, d1bfod2, d1bfoe2, d1bfof2, d1bfog2, d1bfoh2

Details for d1bfof1

PDB Entry: 1bfo (more details), 2.6 Å

PDB Description: campath-1g igg2b rat monoclonal fab

SCOP Domain Sequences for d1bfof1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfof1 b.1.1.1 (F:1-121) Immunoglobulin (variable domains of L and H chains) {CAMPATH-1G igg2b monoclonal fab (rat), kappa L chain}
evkllesggglvqpggsmrlscagsgftftdfymnwirqpagkapewlgfirdkakgytt
eynpsvkgrftisrdntqnmlylqmntlraedtatyycareghtaapfdywgqgvmvtvs
s

SCOP Domain Coordinates for d1bfof1:

Click to download the PDB-style file with coordinates for d1bfof1.
(The format of our PDB-style files is described here.)

Timeline for d1bfof1: