SCOPe 2.03: Domain d1xeua1: 1xeu A:35-216

Lineage for d1xeua1 (1xeu A:35-216)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.0: automated matches [191489] (1 protein)
   not a true family

6. Protein automated matches [190787] (6 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:1639] [225009] (1 PDB entry)

8. Domain d1xeua1: 1xeu A:35-216 [203141]
   Other proteins in same PDB: d1xeua2
   automated match to d1m9sa5

Details for d1xeua1

PDB Entry: 1xeu, 2.05 Å

PDB Description: Crystal Structure of Internalin C from Listeria monocytogenes

PDB Compounds: (A:) internalin C

SCOPe Domain Sequences for d1xeua1:

Sequence; same for both SEQRES and ATOM records:

>d1xeua1 c.10.2.0 (A:35-216) automated matches {Listeria monocytogenes [TaxId: 1639]}
esiqrptpinqvfpdpglanavkqnlgkqsvtdlvsqkelsgvqnfngdnsniqslagmq
fftnlkelhlshnqisdlsplkdltkleelsvnrnrlknlngipsaclsrlfldnnelrd
tdslihlknleilsirnnklksivmlgflsklevldlhgneitntggltrlkkvnwidlt
gq

Timeline for d1xeua1:

• d1xeua1 is new in SCOPe 2.03-stable
  
• d1xeua1 appears in SCOPe 2.04
  
• d1xeua1 appears in the current release, SCOPe 2.08