Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.0: automated matches [191489] (1 protein) not a true family |
Protein automated matches [190787] (6 species) not a true protein |
Species Listeria monocytogenes [TaxId:1639] [225009] (1 PDB entry) |
Domain d1xeua1: 1xeu A:35-216 [203141] Other proteins in same PDB: d1xeua2 automated match to d1m9sa5 |
PDB Entry: 1xeu (more details), 2.05 Å
SCOPe Domain Sequences for d1xeua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xeua1 c.10.2.0 (A:35-216) automated matches {Listeria monocytogenes [TaxId: 1639]} esiqrptpinqvfpdpglanavkqnlgkqsvtdlvsqkelsgvqnfngdnsniqslagmq fftnlkelhlshnqisdlsplkdltkleelsvnrnrlknlngipsaclsrlfldnnelrd tdslihlknleilsirnnklksivmlgflsklevldlhgneitntggltrlkkvnwidlt gq
Timeline for d1xeua1: