Lineage for d1xetd2 (1xet D:239-393)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1626713Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1626714Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1627417Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1627418Protein automated matches [196909] (45 species)
    not a true protein
  7. 1627871Species Scots pine (Pinus sylvestris) [TaxId:3349] [225067] (2 PDB entries)
  8. 1627887Domain d1xetd2: 1xet D:239-393 [203140]
    automated match to d1bi5a2
    complexed with 3io, mca

Details for d1xetd2

PDB Entry: 1xet (more details), 2 Å

PDB Description: crystal structure of stilbene synthase from pinus sylvestris, complexed with methylmalonyl coa
PDB Compounds: (D:) Dihydropinosylvin synthase

SCOPe Domain Sequences for d1xetd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xetd2 c.95.1.0 (D:239-393) automated matches {Scots pine (Pinus sylvestris) [TaxId: 3349]}
cfeivwtaqtvvpnsegaiggkvrevgltfqlkgavpdlisaniencmveafsqfkisdw
nklfwvvhpggraildrveaklnldptkliptrhvmseygnmssacvhfildqtrkaslq
ngcsttgeglemgvlfgfgpgltietvvlksvpiq

SCOPe Domain Coordinates for d1xetd2:

Click to download the PDB-style file with coordinates for d1xetd2.
(The format of our PDB-style files is described here.)

Timeline for d1xetd2: