SCOPe 2.04: Domain d1bfoe1: 1bfo E:1-107

Lineage for d1bfoe1 (1bfo E:1-107)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

Species Norway rat (Rattus norvegicus) [TaxId:10116] [88532] (9 PDB entries)

Domain d1bfoe1: 1bfo E:1-107 [20314]
Other proteins in same PDB: d1bfoa2, d1bfob1, d1bfob2, d1bfoc2, d1bfod1, d1bfod2, d1bfoe2, d1bfof1, d1bfof2, d1bfog2, d1bfoh1, d1bfoh2
part of therapeutic monoclonal antibody CAMPATH-1G

Details for d1bfoe1

PDB Entry: 1bfo (more details), 2.6 Å

PDB Description: campath-1g igg2b rat monoclonal fab

PDB Compounds: (E:) campath-1g antibody

SCOPe Domain Sequences for d1bfoe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfoe1 b.1.1.1 (E:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dikmtqspsflsasvgdrvtlnckasqnidkylnwyqqklgespklliyntnnlqtgips
rfsgsgsgtdftltisslqpedvatyfclqhisrprtfgtgtklelk

SCOPe Domain Coordinates for d1bfoe1:

Click to download the PDB-style file with coordinates for d1bfoe1.
(The format of our PDB-style files is described here.)

Timeline for d1bfoe1: