SCOPe 2.08: Domain d1xetc1: 1xet C:4-238

Lineage for d1xetc1 (1xet C:4-238)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Scots pine (Pinus sylvestris) [TaxId:3349] [225067] (3 PDB entries)

8. Domain d1xetc1: 1xet C:4-238 [203137]
   automated match to d1cmla1
   complexed with 3io, mca

Details for d1xetc1

PDB Entry: 1xet, 2 Å

PDB Description: crystal structure of stilbene synthase from pinus sylvestris, complexed with methylmalonyl coa

PDB Compounds: (C:) Dihydropinosylvin synthase

SCOPe Domain Sequences for d1xetc1:

Sequence, based on SEQRES records:

>d1xetc1 c.95.1.0 (C:4-238) automated matches {Scots pine (Pinus sylvestris) [TaxId: 3349]}
vdfegfrklqradgfasilaigtanppnavdqstypdfyfritgnehntelkdkfkrice
rsaikqrymylteeilkknpdvcafvevpsldarqamlamevprlakeaaekaiqewgqs
ksgithlifcstttpdlpgadfevakllglhpsvkrvgvfqhgcfaggtvlrmakdlaen
nrgarvlvicsettavtfrgpsethldslvgqalfgdgasalivgadpipqveka

Sequence, based on observed residues (ATOM records):

>d1xetc1 c.95.1.0 (C:4-238) automated matches {Scots pine (Pinus sylvestris) [TaxId: 3349]}
vdfegfrklqradgfasilaigtanppnavdqstypdfyfritgnehnfkricersaikq
rymylteeilkknpdvcafvevpsldarqamlamevprlakeaaekaiqewgqsksgith
lifcstttpdlpgadfevakllglhpsvkrvgvfqhgcfaggtvlrmakdlaennrgarv
lvicsettavtfrgpsethdslvgqalfgdgasalivgadpipqveka

Timeline for d1xetc1:

• d1xetc1 first appeared in SCOPe 2.03
  
• d1xetc1 appears in SCOPe 2.07