Lineage for d1bfod1 (1bfo D:1-121)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1511362Species Norway rat (Rattus norvegicus) [TaxId:10116] [88560] (16 PDB entries)
  8. 1511376Domain d1bfod1: 1bfo D:1-121 [20313]
    Other proteins in same PDB: d1bfoa1, d1bfoa2, d1bfob2, d1bfoc1, d1bfoc2, d1bfod2, d1bfoe1, d1bfoe2, d1bfof2, d1bfog1, d1bfog2, d1bfoh2
    part of therapeutic monoclonal antibody CAMPATH-1G

Details for d1bfod1

PDB Entry: 1bfo (more details), 2.6 Å

PDB Description: campath-1g igg2b rat monoclonal fab
PDB Compounds: (D:) campath-1g antibody

SCOPe Domain Sequences for d1bfod1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfod1 b.1.1.1 (D:1-121) Immunoglobulin heavy chain variable domain, VH {Norway rat (Rattus norvegicus) [TaxId: 10116]}
evkllesggglvqpggsmrlscagsgftftdfymnwirqpagkapewlgfirdkakgytt
eynpsvkgrftisrdntqnmlylqmntlraedtatyycareghtaapfdywgqgvmvtvs
s

SCOPe Domain Coordinates for d1bfod1:

Click to download the PDB-style file with coordinates for d1bfod1.
(The format of our PDB-style files is described here.)

Timeline for d1bfod1: