SCOP 1.75: Domain d1bfod1: 1bfo D:1-121

Lineage for d1bfod1 (1bfo D:1-121)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Rat (Rattus norvegicus) [TaxId:10116] [88560] (16 PDB entries)

8. Domain d1bfod1: 1bfo D:1-121 [20313]
   Other proteins in same PDB: d1bfoa1, d1bfoa2, d1bfob2, d1bfoc1, d1bfoc2, d1bfod2, d1bfoe1, d1bfoe2, d1bfof2, d1bfog1, d1bfog2, d1bfoh2
   part of therapeutic monoclonal antibody CAMPATH-1G

Details for d1bfod1

PDB Entry: 1bfo, 2.6 Å

PDB Description: campath-1g igg2b rat monoclonal fab

PDB Compounds: (D:) campath-1g antibody

SCOP Domain Sequences for d1bfod1:

Sequence; same for both SEQRES and ATOM records:

>d1bfod1 b.1.1.1 (D:1-121) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]}
evkllesggglvqpggsmrlscagsgftftdfymnwirqpagkapewlgfirdkakgytt
eynpsvkgrftisrdntqnmlylqmntlraedtatyycareghtaapfdywgqgvmvtvs
s

Timeline for d1bfod1:

• d1bfod1 first appeared (with stable ids) in SCOP 1.55
  
• d1bfod1 appears in SCOP 1.73
  
• d1bfod1 appears in SCOPe 2.01
  
• d1bfod1 appears in the current release, SCOPe 2.08