Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (83 species) not a true protein |
Species Scots pine (Pinus sylvestris) [TaxId:3349] [225067] (3 PDB entries) |
Domain d1xesa1: 1xes A:6-238 [203125] automated match to d1cmla1 complexed with 3io |
PDB Entry: 1xes (more details), 1.7 Å
SCOPe Domain Sequences for d1xesa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xesa1 c.95.1.0 (A:6-238) automated matches {Scots pine (Pinus sylvestris) [TaxId: 3349]} fegfrklqradgfasilaigtanppnavdqstypdfyfritgnehntelkdkfkricers aikqrymylteeilkknpdvcafvevpsldarqamlamevprlakeaaekaiqewgqsks githlifcstttpdlpgadfevakllglhpsvkrvgvfqhgcfaggtvlrmakdlaennr garvlvicsettavtfrgpsethldslvgqalfgdgasalivgadpipqveka
Timeline for d1xesa1: