SCOP 1.63: Domain d1bfoc1: 1bfo C:1-107

Lineage for d1bfoc1 (1bfo C:1-107)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species CAMPATH-1G igg2b monoclonal fab (rat), kappa L chain [48867] (1 PDB entry)

8. Domain d1bfoc1: 1bfo C:1-107 [20312]
   Other proteins in same PDB: d1bfoa2, d1bfob2, d1bfoc2, d1bfod2, d1bfoe2, d1bfof2, d1bfog2, d1bfoh2

Details for d1bfoc1

PDB Entry: 1bfo, 2.6 Å

PDB Description: campath-1g igg2b rat monoclonal fab

SCOP Domain Sequences for d1bfoc1:

Sequence; same for both SEQRES and ATOM records:

>d1bfoc1 b.1.1.1 (C:1-107) Immunoglobulin (variable domains of L and H chains) {CAMPATH-1G igg2b monoclonal fab (rat), kappa L chain}
dikmtqspsflsasvgdrvtlnckasqnidkylnwyqqklgespklliyntnnlqtgips
rfsgsgsgtdftltisslqpedvatyfclqhisrprtfgtgtklelk

Timeline for d1bfoc1:

• d1bfoc1 first appeared (with stable ids) in SCOP 1.55
  
• d1bfoc1 appears in SCOP 1.61
  
• d1bfoc1 appears in SCOP 1.65
  
• d1bfoc1 appears in the current release, SCOPe 2.08