Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species CAMPATH-1G igg2b monoclonal fab (rat), kappa L chain [48867] (1 PDB entry) |
Domain d1bfoc1: 1bfo C:1-107 [20312] Other proteins in same PDB: d1bfoa2, d1bfob2, d1bfoc2, d1bfod2, d1bfoe2, d1bfof2, d1bfog2, d1bfoh2 |
PDB Entry: 1bfo (more details), 2.6 Å
SCOP Domain Sequences for d1bfoc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bfoc1 b.1.1.1 (C:1-107) Immunoglobulin (variable domains of L and H chains) {CAMPATH-1G igg2b monoclonal fab (rat), kappa L chain} dikmtqspsflsasvgdrvtlnckasqnidkylnwyqqklgespklliyntnnlqtgips rfsgsgsgtdftltisslqpedvatyfclqhisrprtfgtgtklelk
Timeline for d1bfoc1: