![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
![]() | Species CAMPATH-1G igg2b monoclonal fab (rat), kappa L chain [48867] (1 PDB entry) |
![]() | Domain d1bfoc1: 1bfo C:1-107 [20312] Other proteins in same PDB: d1bfoa2, d1bfob2, d1bfoc2, d1bfod2, d1bfoe2, d1bfof2, d1bfog2, d1bfoh2 |
PDB Entry: 1bfo (more details), 2.6 Å
SCOP Domain Sequences for d1bfoc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bfoc1 b.1.1.1 (C:1-107) Immunoglobulin (variable domains of L and H chains) {CAMPATH-1G igg2b monoclonal fab (rat), kappa L chain} dikmtqspsflsasvgdrvtlnckasqnidkylnwyqqklgespklliyntnnlqtgips rfsgsgsgtdftltisslqpedvatyfclqhisrprtfgtgtklelk
Timeline for d1bfoc1: