Lineage for d1xckc2 (1xck C:137-190,C:367-409)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906067Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. 1906068Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. 1906069Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein)
  6. 1906070Protein GroEL, I domain [54851] (4 species)
  7. 1906071Species Escherichia coli [TaxId:562] [54852] (11 PDB entries)
  8. 1906088Domain d1xckc2: 1xck C:137-190,C:367-409 [203090]
    Other proteins in same PDB: d1xcka1, d1xcka3, d1xckb1, d1xckb3, d1xckc1, d1xckc3, d1xckd1, d1xckd3, d1xcke1, d1xcke3, d1xckf1, d1xckf3, d1xckg1, d1xckg3, d1xckh1, d1xckh3, d1xcki1, d1xcki3, d1xckj1, d1xckj3, d1xckk1, d1xckk3, d1xckl1, d1xckl3, d1xckm1, d1xckm3, d1xckn1, d1xckn3
    automated match to d1mnfa3
    complexed with k, mpd, peg, so4

Details for d1xckc2

PDB Entry: 1xck (more details), 2.92 Å

PDB Description: Crystal structure of apo GroEL
PDB Compounds: (C:) 60 kda chaperonin

SCOPe Domain Sequences for d1xckc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xckc2 d.56.1.1 (C:137-190,C:367-409) GroEL, I domain {Escherichia coli [TaxId: 562]}
pcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqdeldvvXervak
laggvavikvgaatevemkekkarvedalhatraavee

SCOPe Domain Coordinates for d1xckc2:

Click to download the PDB-style file with coordinates for d1xckc2.
(The format of our PDB-style files is described here.)

Timeline for d1xckc2: