![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
![]() | Species Humanized and chimeric anti-gamma-interferon Fab [48866] (2 PDB entries) |
![]() | Domain d1b4jh1: 1b4j H:1-117 [20309] Other proteins in same PDB: d1b4jh2, d1b4jl2 |
PDB Entry: 1b4j (more details), 2.9 Å
SCOP Domain Sequences for d1b4jh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b4jh1 b.1.1.1 (H:1-117) Immunoglobulin (variable domains of L and H chains) {Humanized and chimeric anti-gamma-interferon Fab} evqlqqpgadlvmpgapvklsclasgyiftsswinwvkqrpgrglewigridpsdgevhy nqdfkdkatltvdkssstayiqlnsltsedsavyycargflpwfadwgqgtlvtvsa
Timeline for d1b4jh1: