Lineage for d1b4jl1 (1b4j L:1-107)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 220048Species Humanized and chimeric anti-gamma-interferon Fab [48866] (2 PDB entries)
  8. 220052Domain d1b4jl1: 1b4j L:1-107 [20308]
    Other proteins in same PDB: d1b4jh2, d1b4jl2

Details for d1b4jl1

PDB Entry: 1b4j (more details), 2.9 Å

PDB Description: comparison of the three-dimensional structures of a humanized and a chimeric fab of an anti-gamma-interferon antibody

SCOP Domain Sequences for d1b4jl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b4jl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Humanized and chimeric anti-gamma-interferon Fab}
nivmtqspksmyvsigervtlsckasenvdtyvswyqqkpeqspklliygasnrytgvpd
rftgsgsatdftltissvqaedladyhcgqsynypftfgsgtkleik

SCOP Domain Coordinates for d1b4jl1:

Click to download the PDB-style file with coordinates for d1b4jl1.
(The format of our PDB-style files is described here.)

Timeline for d1b4jl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b4jl2