Lineage for d1b2wh1 (1b2w H:1-117)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 362751Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 362752Species Engineered (including hybrid species) [88562] (28 PDB entries)
  8. 362782Domain d1b2wh1: 1b2w H:1-117 [20307]
    Other proteins in same PDB: d1b2wh2, d1b2wl1, d1b2wl2
    part of a humanized anti-gamma-interferon Fab

Details for d1b2wh1

PDB Entry: 1b2w (more details), 2.9 Å

PDB Description: comparison of the three-dimensional structures of a humanized and a chimeric fab of an anti-gamma-interferon antibody

SCOP Domain Sequences for d1b2wh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b2wh1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqlvqsgggvvqpgrslklsclasgyiftsswinwvkqrpgrglewigridpsdgevhy
nqdfkdrftisrdkskntlylqmnslrpedtavyycargflpwfadwgqgtlvtvss

SCOP Domain Coordinates for d1b2wh1:

Click to download the PDB-style file with coordinates for d1b2wh1.
(The format of our PDB-style files is described here.)

Timeline for d1b2wh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b2wh2