Lineage for d1b2wh1 (1b2w H:1-117)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7929Species Humanized and chimeric anti-gamma-interferon Fab [48866] (2 PDB entries)
  8. 7930Domain d1b2wh1: 1b2w H:1-117 [20307]
    Other proteins in same PDB: d1b2wh2, d1b2wl2

Details for d1b2wh1

PDB Entry: 1b2w (more details), 2.9 Å

PDB Description: comparison of the three-dimensional structures of a humanized and a chimeric fab of an anti-gamma-interferon antibody

SCOP Domain Sequences for d1b2wh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b2wh1 b.1.1.1 (H:1-117) Immunoglobulin (variable domains of L and H chains) {Humanized and chimeric anti-gamma-interferon Fab}
evqlvqsgggvvqpgrslklsclasgyiftsswinwvkqrpgrglewigridpsdgevhy
nqdfkdrftisrdkskntlylqmnslrpedtavyycargflpwfadwgqgtlvtvss

SCOP Domain Coordinates for d1b2wh1:

Click to download the PDB-style file with coordinates for d1b2wh1.
(The format of our PDB-style files is described here.)

Timeline for d1b2wh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b2wh2