SCOPe 2.05: Domain d1x0xa1: 1x0x A:0-193

Lineage for d1x0xa1 (1x0x A:0-193)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186944] (39 PDB entries)

8. Domain d1x0xa1: 1x0x A:0-193 [203069]
   Other proteins in same PDB: d1x0xa2
   automated match to d1evya2
   complexed with nad, so4

Details for d1x0xa1

PDB Entry: 1x0x, 2.75 Å

PDB Description: co-structure of homo sapiens glycerol-3-phosphate dehydrogenase 1 complex with nad

PDB Compounds: (A:) Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic

SCOPe Domain Sequences for d1x0xa1:

Sequence; same for both SEQRES and ATOM records:

>d1x0xa1 c.2.1.0 (A:0-193) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smaskkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiintqhe
nvkylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanatgisli
kgvdegpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllke
lmqtpnfritvvqe

Timeline for d1x0xa1:

• d1x0xa1 first appeared in SCOPe 2.03
  
• d1x0xa1 appears in SCOPe 2.04
  
• d1x0xa1 appears in SCOPe 2.06
  
• d1x0xa1 appears in the current release, SCOPe 2.08