SCOPe 2.04: Domain d1x0vb2: 1x0v B:194-349

Lineage for d1x0vb2 (1x0v B:194-349)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225061] (13 PDB entries)

8. Domain d1x0vb2: 1x0v B:194-349 [203068]
   Other proteins in same PDB: d1x0va1, d1x0vb1
   automated match to d1evya1
   complexed with so4

Details for d1x0vb2

PDB Entry: 1x0v, 2.3 Å

PDB Description: Crystal Structure of Homo Sapien Glycerol-3-Phosphate Dehydrogenase 1

PDB Compounds: (B:) Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic

SCOPe Domain Sequences for d1x0vb2:

Sequence; same for both SEQRES and ATOM records:

>d1x0vb2 a.100.1.0 (B:194-349) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdtveicgalknvvavgagfcdglgfgdntkaavirlglmemiafaklfcsgpvssatfl
escgvadlittcyggrnrkvaeafartgksieqlekellngqklqgpetarelysilqhk
glvdkfplfmavykvcyegqpvgefihclqnhpehm

Timeline for d1x0vb2:

• d1x0vb2 first appeared in SCOPe 2.03
  
• d1x0vb2 appears in SCOPe 2.05
  
• d1x0vb2 appears in the current release, SCOPe 2.08