SCOP 1.57: Domain d1b2wl1: 1b2w L:1-107

Lineage for d1b2wl1 (1b2w L:1-107)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Humanized and chimeric anti-gamma-interferon Fab [48866] (2 PDB entries)

8. Domain d1b2wl1: 1b2w L:1-107 [20306]
   Other proteins in same PDB: d1b2wh2, d1b2wl2

Details for d1b2wl1

PDB Entry: 1b2w, 2.9 Å

PDB Description: comparison of the three-dimensional structures of a humanized and a chimeric fab of an anti-gamma-interferon antibody

SCOP Domain Sequences for d1b2wl1:

Sequence; same for both SEQRES and ATOM records:

>d1b2wl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Humanized and chimeric anti-gamma-interferon Fab}
diqmtqspstlsasvgdrvtitckasenvdtyvswyqqkpgkapklliygasnrytgvps
rfsgsgsgtdftltisslqpddfatyycgqsynypftfgqgtkvevk

Timeline for d1b2wl1:

• d1b2wl1 first appeared (with stable ids) in SCOP 1.55
  
• d1b2wl1 appears in SCOP 1.59
  
• d1b2wl1 appears in the current release, SCOPe 2.08