SCOP 1.59: Domain d1axth1: 1axt H:1-113

Lineage for d1axth1 (1axt H:1-113)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Catalytic Fab 33F12 (mouse), kappa L chain [48865] (1 PDB entry)

8. Domain d1axth1: 1axt H:1-113 [20305]
   Other proteins in same PDB: d1axth2, d1axtl2

Details for d1axth1

PDB Entry: 1axt, 2.15 Å

PDB Description: immune versus natural selection: antibody aldolases with the rates of natural enzymes

SCOP Domain Sequences for d1axth1:

Sequence; same for both SEQRES and ATOM records:

>d1axth1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Catalytic Fab 33F12 (mouse), kappa L chain}
evkleesggglvqpggsmklscvvsgltfsrfwmswvrqspekglewvaeirlksdnyat
hyaesvkgkftisrddsksrlylqmnslrtedtgiyyckiyfysfsywgqgtlvtvsa

Timeline for d1axth1:

• d1axth1 first appeared (with stable ids) in SCOP 1.55
  
• d1axth1 appears in SCOP 1.57
  
• d1axth1 appears in SCOP 1.61
  
• d1axth1 appears in the current release, SCOPe 2.08