Lineage for d1axth1 (1axt H:1-113)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 51946Species Catalytic Fab 33F12 (mouse), kappa L chain [48865] (1 PDB entry)
  8. 51947Domain d1axth1: 1axt H:1-113 [20305]
    Other proteins in same PDB: d1axth2, d1axtl2

Details for d1axth1

PDB Entry: 1axt (more details), 2.15 Å

PDB Description: immune versus natural selection: antibody aldolases with the rates of natural enzymes

SCOP Domain Sequences for d1axth1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axth1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Catalytic Fab 33F12 (mouse), kappa L chain}
evkleesggglvqpggsmklscvvsgltfsrfwmswvrqspekglewvaeirlksdnyat
hyaesvkgkftisrddsksrlylqmnslrtedtgiyyckiyfysfsywgqgtlvtvsa

SCOP Domain Coordinates for d1axth1:

Click to download the PDB-style file with coordinates for d1axth1.
(The format of our PDB-style files is described here.)

Timeline for d1axth1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1axth2