| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
| Species Catalytic Fab 33F12 (mouse), kappa L chain [48865] (1 PDB entry) |
| Domain d1axth1: 1axt H:1-113 [20305] Other proteins in same PDB: d1axth2, d1axtl2 |
PDB Entry: 1axt (more details), 2.15 Å
SCOP Domain Sequences for d1axth1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1axth1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Catalytic Fab 33F12 (mouse), kappa L chain}
evkleesggglvqpggsmklscvvsgltfsrfwmswvrqspekglewvaeirlksdnyat
hyaesvkgkftisrddsksrlylqmnslrtedtgiyyckiyfysfsywgqgtlvtvsa
Timeline for d1axth1: