SCOP 1.69: Domain d1axtl1: 1axt L:1-107

Lineage for d1axtl1 (1axt L:1-107)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (126 PDB entries)

8. Domain d1axtl1: 1axt L:1-107 [20304]
   Other proteins in same PDB: d1axth1, d1axth2, d1axtl2
   part of catalytic Fab 33F12 with an aldolase activity

Details for d1axtl1

PDB Entry: 1axt, 2.15 Å

PDB Description: immune versus natural selection: antibody aldolases with the rates of natural enzymes

SCOP Domain Sequences for d1axtl1:

Sequence; same for both SEQRES and ATOM records:

>d1axtl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
elvmtqtplslpvslgdqasiscrssqslvhsygntflnwylqksgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqgthvpytfgggtkleik

Timeline for d1axtl1:

• d1axtl1 first appeared (with stable ids) in SCOP 1.55
  
• d1axtl1 appears in SCOP 1.67
  
• d1axtl1 appears in SCOP 1.71
  
• d1axtl1 appears in the current release, SCOPe 2.08