Lineage for d1axtl1 (1axt L:1-107)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219332Species Catalytic Fab 33F12 (mouse), kappa L chain [48865] (1 PDB entry)
    has an aldolase activity
  8. 219334Domain d1axtl1: 1axt L:1-107 [20304]
    Other proteins in same PDB: d1axth2, d1axtl2

Details for d1axtl1

PDB Entry: 1axt (more details), 2.15 Å

PDB Description: immune versus natural selection: antibody aldolases with the rates of natural enzymes

SCOP Domain Sequences for d1axtl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1axtl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Catalytic Fab 33F12 (mouse), kappa L chain}
elvmtqtplslpvslgdqasiscrssqslvhsygntflnwylqksgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqgthvpytfgggtkleik

SCOP Domain Coordinates for d1axtl1:

Click to download the PDB-style file with coordinates for d1axtl1.
(The format of our PDB-style files is described here.)

Timeline for d1axtl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1axtl2