![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (23 species) not a true protein |
![]() | Species Agrocybe cylindracea [TaxId:64608] [225007] (6 PDB entries) |
![]() | Domain d1ww4b_: 1ww4 B: [203034] automated match to d2r0hb_ |
PDB Entry: 1ww4 (more details), 2.3 Å
SCOPe Domain Sequences for d1ww4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ww4b_ b.29.1.0 (B:) automated matches {Agrocybe cylindracea [TaxId: 64608]} ttsavniynisagasvdlaapvttgdivtffssalnlsagagspnntalnllsengayll hiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinek tviqytkqisgttsslsynstegtsifstvveavtytgla
Timeline for d1ww4b_: