Lineage for d1a5fh1 (1a5f H:1-120)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352672Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353147Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (31 PDB entries)
    SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)
  8. 2353179Domain d1a5fh1: 1a5f H:1-120 [20303]
    Other proteins in same PDB: d1a5fh2, d1a5fl1, d1a5fl2
    part of an anti-E-selectin Fab

Details for d1a5fh1

PDB Entry: 1a5f (more details), 2.8 Å

PDB Description: fab fragment of a monoclonal anti-e-selectin antibody
PDB Compounds: (H:) monoclonal anti-e-selectin 7a9 antibody (heavy chain)

SCOPe Domain Sequences for d1a5fh1:

Sequence, based on SEQRES records: (download)

>d1a5fh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
evalqqsgaelvkpgasvklscaasgftikdaymhwvkqkpeqglewigridsgssntny
dptfkgkatitaddssntaylqmssltsedtavyycarvglsywyamdywgqgtsvtvss

Sequence, based on observed residues (ATOM records): (download)

>d1a5fh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
evalqqsgaelvkpgasvklscaasgftikdaymhwvkqkpeqglewigridsgssntny
dptfkgkatitaddssntaylqmssltsedtavyycarvyamdywgqgtsvtvss

SCOPe Domain Coordinates for d1a5fh1:

Click to download the PDB-style file with coordinates for d1a5fh1.
(The format of our PDB-style files is described here.)

Timeline for d1a5fh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a5fh2