Lineage for d1wvra2 (1wvr A:165-221)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2261052Fold g.19: Crisp domain-like [57545] (1 superfamily)
    disulfide-rich all-alpha fold
  4. 2261053Superfamily g.19.1: Crisp domain-like [57546] (3 families) (S)
  5. 2261066Family g.19.1.0: automated matches [227153] (1 protein)
    not a true family
  6. 2261067Protein automated matches [226858] (4 species)
    not a true protein
  7. 2261078Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [224989] (1 PDB entry)
  8. 2261079Domain d1wvra2: 1wvr A:165-221 [203026]
    Other proteins in same PDB: d1wvra1
    automated match to d1rc9a2
    complexed with cd

Details for d1wvra2

PDB Entry: 1wvr (more details), 2.4 Å

PDB Description: crystal structure of a crisp family ca-channel blocker derived from snake venom
PDB Compounds: (A:) Triflin

SCOPe Domain Sequences for d1wvra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wvra2 g.19.1.0 (A:165-221) automated matches {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]}
ppcgdcpsdcdnglctnpctreneftncdslvqksscqdnymkskcpascfcqnkii

SCOPe Domain Coordinates for d1wvra2:

Click to download the PDB-style file with coordinates for d1wvra2.
(The format of our PDB-style files is described here.)

Timeline for d1wvra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wvra1