SCOPe 2.08: Domain d1wvra1: 1wvr A:1-164

Lineage for d1wvra1 (1wvr A:1-164)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.111: PR-1-like [55796] (1 superfamily)
   alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342

4. Superfamily d.111.1: PR-1-like [55797] (2 families)

5. Family d.111.1.1: PR-1-like [55798] (5 proteins)
   Pfam PF00188; groups mammalian SCP/TPX1; insects AG3/AG5; fungi SC7/SC14 and plant PR-1

6. Protein automated matches [194852] (4 species)
   not a true protein

7. Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [224988] (1 PDB entry)

8. Domain d1wvra1: 1wvr A:1-164 [203025]
   Other proteins in same PDB: d1wvra2
   automated match to d1rc9a1
   complexed with cd

Details for d1wvra1

PDB Entry: 1wvr, 2.4 Å

PDB Description: crystal structure of a crisp family ca-channel blocker derived from snake venom

PDB Compounds: (A:) Triflin

SCOPe Domain Sequences for d1wvra1:

Sequence; same for both SEQRES and ATOM records:

>d1wvra1 d.111.1.1 (A:1-164) automated matches {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]}
nvdfdsesprkpeiqneiidlhnslrrsvnptasnmlkmewypeaaanaerwayrciesh
ssrdsrviggikcgeniymatypakwtdiihawhgeykdfkygvgavpsdavighytqiv
wyksyragcaaaycpsskysyfyvcqycpagniigktatpyksg

Timeline for d1wvra1:

• d1wvra1 first appeared in SCOPe 2.03
  
• d1wvra1 appears in SCOPe 2.07