SCOPe 2.06: Domain d1wpqa1: 1wpq A:2-193

Lineage for d1wpqa1 (1wpq A:2-193)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186944] (46 PDB entries)

8. Domain d1wpqa1: 1wpq A:2-193 [203013]
   Other proteins in same PDB: d1wpqa2, d1wpqb2
   automated match to d1evya2
   complexed with 13p, nad, so4

Details for d1wpqa1

PDB Entry: 1wpq, 2.5 Å

PDB Description: Ternary Complex Of Glycerol 3-phosphate Dehydrogenase 1 with NAD and dihydroxyactone

PDB Compounds: (A:) Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic

SCOPe Domain Sequences for d1wpqa1:

Sequence; same for both SEQRES and ATOM records:

>d1wpqa1 c.2.1.0 (A:2-193) automated matches {Human (Homo sapiens) [TaxId: 9606]}
askkvcivgsgnwgsaiakivggnaaqlaqfdprvtmwvfeediggkklteiintqhenv
kylpghklppnvvavpdvvqaaedadilifvvphqfigkicdqlkghlkanptgislikg
vdegpnglklisevigerlgipmsvlmganiasevadekfcettigckdpaqgqllkelm
qtpnfritvvqe

Timeline for d1wpqa1:

• d1wpqa1 first appeared in SCOPe 2.03
  
• d1wpqa1 appears in SCOPe 2.05
  
• d1wpqa1 appears in SCOPe 2.07
  
• d1wpqa1 appears in the current release, SCOPe 2.08