SCOPe 2.04: Domain d15c8h1: 15c8 H:1-113

Lineage for d15c8h1 (15c8 H:1-113)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (31 PDB entries)
   SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)

8. Domain d15c8h1: 15c8 H:1-113 [20301]
   Other proteins in same PDB: d15c8h2, d15c8l1, d15c8l2
   part of catalytic Fab 5C8

Details for d15c8h1

PDB Entry: 15c8, 2.5 Å

PDB Description: catalytic antibody 5c8, free fab

PDB Compounds: (H:) igg 5c8 fab (heavy chain)

SCOPe Domain Sequences for d15c8h1:

Sequence; same for both SEQRES and ATOM records:

>d15c8h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
evqlqqsgaelvkpgasvklsctasgfnikdtymhwvkqkpeqglewiaqidpangntky
dpkfqgkatitadtssntaylhlssltsedsavyycaadppyyghgdywgqgttltvss

Timeline for d15c8h1:

• d15c8h1 first appeared (with stable ids) in SCOP 1.55
  
• d15c8h1 appears in SCOPe 2.03
  
• d15c8h1 appears in SCOPe 2.05
  
• d15c8h1 appears in the current release, SCOPe 2.08