Class a: All alpha proteins [46456] (284 folds) |
Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) |
Family a.40.1.0: automated matches [227151] (1 protein) not a true family |
Protein automated matches [226856] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224978] (13 PDB entries) |
Domain d1wkub2: 1wku B:156-268 [203000] automated match to d1sh5a2 |
PDB Entry: 1wku (more details), 1.6 Å
SCOPe Domain Sequences for d1wkub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wkub2 a.40.1.0 (B:156-268) automated matches {Human (Homo sapiens) [TaxId: 9606]} eetsakeglllwcqrktapyrnvnvqnfhtswkdglalcalihrhrpdlidyaklrkddp ignlntafevaekyldipkmldaedivntpkpdekaimtyvscfyhafagaeq
Timeline for d1wkub2: