SCOPe 2.03: Domain d1wkua2: 1wku A:156-266

Lineage for d1wkua2 (1wku A:156-266)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.0: automated matches [227151] (1 protein)
   not a true family

6. Protein automated matches [226856] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224978] (13 PDB entries)

8. Domain d1wkua2: 1wku A:156-266 [202998]
   automated match to d1sh5a2

Details for d1wkua2

PDB Entry: 1wku, 1.6 Å

PDB Description: High resolution structure of the human alpha-actinin isoform 3

PDB Compounds: (A:) Alpha-actinin 3

SCOPe Domain Sequences for d1wkua2:

Sequence; same for both SEQRES and ATOM records:

>d1wkua2 a.40.1.0 (A:156-266) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eetsakeglllwcqrktapyrnvnvqnfhtswkdglalcalihrhrpdlidyaklrkddp
ignlntafevaekyldipkmldaedivntpkpdekaimtyvscfyhafaga

Timeline for d1wkua2:

• d1wkua2 is new in SCOPe 2.03-stable
  
• d1wkua2 appears in SCOPe 2.04
  
• d1wkua2 appears in the current release, SCOPe 2.08