SCOPe 2.08: Domain d1wcfa1: 1wcf A:1-161

Lineage for d1wcfa1 (1wcf A:1-161)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families)

5. Family b.40.5.0: automated matches [191399] (1 protein)
   not a true family

6. Protein automated matches [190523] (12 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [225097] (8 PDB entries)

8. Domain d1wcfa1: 1wcf A:1-161 [202990]
   Other proteins in same PDB: d1wcfa2
   automated match to d4ecpb_
   complexed with k, po4

Details for d1wcfa1

PDB Entry: 1wcf, 1.54 Å

PDB Description: 1.54 a crystal structure of rv3628, mycobacterium tuberculosis inorganic pyrophosphatase (ppase) at ph7.0

PDB Compounds: (A:) inorganic pyrophosphatase

SCOPe Domain Sequences for d1wcfa1:

Sequence; same for both SEQRES and ATOM records:

>d1wcfa1 b.40.5.0 (A:1-161) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mqfdvtieipkgqrnkyevdhetgrvrldrylytpmayptdygfiedtlgddgdpldalv
llpqpvfpgvlvaarpvgmfrmvdehggddkvlcvpagdprwdhvqdigdvpafeldaik
hffvhykdlepgkfvkaadwvdraeaeaevqrsverfkagt

Timeline for d1wcfa1:

• d1wcfa1 first appeared in SCOPe 2.03, called d1wcfa_
  
• d1wcfa1 appears in SCOPe 2.07