SCOP 1.57: Domain d25c8h1: 25c8 H:1-113

Lineage for d25c8h1 (25c8 H:1-113)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Catalytic Fab 5C8 (mouse), kappa L chain [48863] (3 PDB entries)

8. Domain d25c8h1: 25c8 H:1-113 [20299]
   Other proteins in same PDB: d25c8h2, d25c8l2

Details for d25c8h1

PDB Entry: 25c8, 2 Å

PDB Description: catalytic antibody 5c8, fab-hapten complex

SCOP Domain Sequences for d25c8h1:

Sequence; same for both SEQRES and ATOM records:

>d25c8h1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Catalytic Fab 5C8 (mouse), kappa L chain}
evqlqqsgaelvkpgasvklsctasgfnikdtymhwvkqkpeqglewiaqidpangntky
dpkfqgkatitadtssntaylhlssltsedsavyycaadppyyghgdywgqgttltvss

Timeline for d25c8h1:

• d25c8h1 first appeared (with stable ids) in SCOP 1.55
  
• d25c8h1 appears in SCOP 1.59
  
• d25c8h1 appears in the current release, SCOPe 2.08