SCOP 1.59: Domain d25c8l1: 25c8 L:1-107

Lineage for d25c8l1 (25c8 L:1-107)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Catalytic Fab 5C8 (mouse), kappa L chain [48863] (3 PDB entries)

8. Domain d25c8l1: 25c8 L:1-107 [20298]
   Other proteins in same PDB: d25c8h2, d25c8l2

Details for d25c8l1

PDB Entry: 25c8, 2 Å

PDB Description: catalytic antibody 5c8, fab-hapten complex

SCOP Domain Sequences for d25c8l1:

Sequence; same for both SEQRES and ATOM records:

>d25c8l1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Catalytic Fab 5C8 (mouse), kappa L chain}
divltqspaimsaslgervtmtctasssvsssnlhwyqqkpgsspklwiystsnlasgvp
arfsgsgsgtsysltissmeaedaatyychqyhrspytfgggtkleik

Timeline for d25c8l1:

• d25c8l1 first appeared (with stable ids) in SCOP 1.55
  
• d25c8l1 appears in SCOP 1.57
  
• d25c8l1 appears in SCOP 1.61
  
• d25c8l1 appears in the current release, SCOPe 2.08