Lineage for d1w1ta2 (1w1t A:292-379)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941865Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 2941866Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 2941925Protein Chitinase B [54560] (1 species)
  7. 2941926Species Serratia marcescens [TaxId:615] [54561] (18 PDB entries)
  8. 2941935Domain d1w1ta2: 1w1t A:292-379 [202961]
    Other proteins in same PDB: d1w1ta1, d1w1ta3, d1w1tb1, d1w1tb3
    automated match to d1o6ia3
    complexed with chq, gol, so4

Details for d1w1ta2

PDB Entry: 1w1t (more details), 1.9 Å

PDB Description: Crystal structure of S. marcescens chitinase B in complex with the cyclic dipeptide inhibitor cyclo-(His-L-Pro) at 1.9 A resolution
PDB Compounds: (A:) chitinase b

SCOPe Domain Sequences for d1w1ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w1ta2 d.26.3.1 (A:292-379) Chitinase B {Serratia marcescens [TaxId: 615]}
ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg
nygyqrlwndktktpylyhaqnglfvty

SCOPe Domain Coordinates for d1w1ta2:

Click to download the PDB-style file with coordinates for d1w1ta2.
(The format of our PDB-style files is described here.)

Timeline for d1w1ta2: