Lineage for d1w1pa3 (1w1p A:447-499)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2077689Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 2077838Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family) (S)
  5. 2077839Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins)
  6. 2077846Protein Chitinase B, C-terminal domain [51061] (1 species)
  7. 2077847Species Serratia marcescens [TaxId:615] [51062] (18 PDB entries)
  8. 2077872Domain d1w1pa3: 1w1p A:447-499 [202956]
    Other proteins in same PDB: d1w1pa1, d1w1pa2, d1w1pb1, d1w1pb2
    automated match to d1o6ia1
    complexed with gio, gol, so4

Details for d1w1pa3

PDB Entry: 1w1p (more details), 2.1 Å

PDB Description: crystal structure of s. marcescens chitinase b in complex with the cyclic dipeptide inhibitor cyclo-(gly-l-pro) at 2.1 a resolution
PDB Compounds: (A:) chitinase b

SCOPe Domain Sequences for d1w1pa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w1pa3 b.72.2.1 (A:447-499) Chitinase B, C-terminal domain {Serratia marcescens [TaxId: 615]}
nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrva

SCOPe Domain Coordinates for d1w1pa3:

Click to download the PDB-style file with coordinates for d1w1pa3.
(The format of our PDB-style files is described here.)

Timeline for d1w1pa3: