SCOP 1.73: Domain d1eo8h1: 1eo8 H:1-113

Lineage for d1eo8h1 (1eo8 H:1-113)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)

8. Domain d1eo8h1: 1eo8 H:1-113 [20295]
   Other proteins in same PDB: d1eo8a_, d1eo8b_, d1eo8h2, d1eo8l1, d1eo8l2
   part of Influenza virus hemagglutinin-neutralizing Fab BH151
   complexed with man, nag

Details for d1eo8h1

PDB Entry: 1eo8, 2.8 Å

PDB Description: influenza virus hemagglutinin complexed with a neutralizing antibody

PDB Compounds: (H:) antibody (heavy chain)

SCOP Domain Sequences for d1eo8h1:

Sequence; same for both SEQRES and ATOM records:

>d1eo8h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqlqqsgaelmkpgpsvkisckatgysfstyfiewirqrpghglewigeilpgsdntnf
nekfkdratftadtpsntaymqlssltsedsavyycarptgrlwfsywgqgtlvtvsa

Timeline for d1eo8h1:

• d1eo8h1 first appeared (with stable ids) in SCOP 1.55
  
• d1eo8h1 appears in SCOP 1.71
  
• d1eo8h1 appears in SCOP 1.75
  
• d1eo8h1 appears in the current release, SCOPe 2.08