SCOP 1.69: Domain d1eo8l1: 1eo8 L:1-106B

Lineage for d1eo8l1 (1eo8 L:1-106B)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (19 PDB entries)

8. Domain d1eo8l1: 1eo8 L:1-106B [20294]
   Other proteins in same PDB: d1eo8a_, d1eo8b_, d1eo8h1, d1eo8h2, d1eo8l2
   part of Influenza virus hemagglutinin-neutralizing Fab BH151

Details for d1eo8l1

PDB Entry: 1eo8, 2.8 Å

PDB Description: influenza virus hemagglutinin complexed with a neutralizing antibody

SCOP Domain Sequences for d1eo8l1:

Sequence; same for both SEQRES and ATOM records:

>d1eo8l1 b.1.1.1 (L:1-106B) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2}
qiiltqspaimsaspgekvtmtcsassdisymhwyqqksdtspkiwiydtsklasgvpar
fsgsgsgtsysltistmeaedaatyychqrssyptfgggtkleik

Timeline for d1eo8l1:

• d1eo8l1 first appeared (with stable ids) in SCOP 1.55
  
• d1eo8l1 appears in SCOP 1.67
  
• d1eo8l1 appears in SCOP 1.71
  
• d1eo8l1 appears in the current release, SCOPe 2.08