Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
Species Influenza virus hemagglutinin-neutralizing Fab BH151 (mouse), kappa L chain [48862] (1 PDB entry) |
Domain d1eo8l1: 1eo8 L:1-106B [20294] Other proteins in same PDB: d1eo8a_, d1eo8b_, d1eo8h2, d1eo8l2 |
PDB Entry: 1eo8 (more details), 2.8 Å
SCOP Domain Sequences for d1eo8l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eo8l1 b.1.1.1 (L:1-106B) Immunoglobulin (variable domains of L and H chains) {Influenza virus hemagglutinin-neutralizing Fab BH151 (mouse), kappa L chain} qiiltqspaimsaspgekvtmtcsassdisymhwyqqksdtspkiwiydtsklasgvpar fsgsgsgtsysltistmeaedaatyychqrssyptfgggtkleik
Timeline for d1eo8l1:
View in 3D Domains from other chains: (mouse over for more information) d1eo8a_, d1eo8b_, d1eo8h1, d1eo8h2 |