Lineage for d1eo8l1 (1eo8 L:1-106B)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52643Species Influenza virus hemagglutinin-neutralizing Fab BH151 (mouse), kappa L chain [48862] (1 PDB entry)
  8. 52645Domain d1eo8l1: 1eo8 L:1-106B [20294]
    Other proteins in same PDB: d1eo8a_, d1eo8b_, d1eo8h2, d1eo8l2

Details for d1eo8l1

PDB Entry: 1eo8 (more details), 2.8 Å

PDB Description: influenza virus hemagglutinin complexed with a neutralizing antibody

SCOP Domain Sequences for d1eo8l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eo8l1 b.1.1.1 (L:1-106B) Immunoglobulin (variable domains of L and H chains) {Influenza virus hemagglutinin-neutralizing Fab BH151 (mouse), kappa L chain}
qiiltqspaimsaspgekvtmtcsassdisymhwyqqksdtspkiwiydtsklasgvpar
fsgsgsgtsysltistmeaedaatyychqrssyptfgggtkleik

SCOP Domain Coordinates for d1eo8l1:

Click to download the PDB-style file with coordinates for d1eo8l1.
(The format of our PDB-style files is described here.)

Timeline for d1eo8l1: