Lineage for d1v6aa2 (1v6a A:161-332)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938734Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1938735Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1939262Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 1939263Protein automated matches [226850] (26 species)
    not a true protein
  7. 1939314Species Carp (Cyprinus carpio) [TaxId:7962] [224962] (1 PDB entry)
  8. 1939315Domain d1v6aa2: 1v6a A:161-332 [202934]
    Other proteins in same PDB: d1v6aa1, d1v6ab1
    automated match to d9ldta2
    complexed with tre

Details for d1v6aa2

PDB Entry: 1v6a (more details), 2.3 Å

PDB Description: crystal structure of l-lactate dehydrogenase from cyprinus carpio
PDB Compounds: (A:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d1v6aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v6aa2 d.162.1.0 (A:161-332) automated matches {Carp (Cyprinus carpio) [TaxId: 7962]}
sgtnldsarfrhlmgeklgihpsnchgwvigehgdssvpvwsgvnvagvflqglnpdmgt
dkdkedwksvhkmvvdsayeviklkgytswaigmsaadlcqsilknlrkchpvstlvkgm
hgvneevflsvpcilgnsgltdvvhmtlksdeekqlvksaetlwgvqkdltl

SCOPe Domain Coordinates for d1v6aa2:

Click to download the PDB-style file with coordinates for d1v6aa2.
(The format of our PDB-style files is described here.)

Timeline for d1v6aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v6aa1