Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (61 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [196003] (2 PDB entries) |
Domain d1t90c_: 1t90 C: [202915] automated match to d1o9ja_ complexed with nad |
PDB Entry: 1t90 (more details), 2.5 Å
SCOPe Domain Sequences for d1t90c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t90c_ c.82.1.0 (C:) automated matches {Bacillus subtilis [TaxId: 1423]} eirklknyingewvesktdqyedvvnpatkevlcqvpistkedidyaaqtaaeafktwsk vavprrarilfnfqqllsqhkeelahlitiengkntkealgevgrgienvefaagapslm mgdslasiatdveaanyrypigvvggiapfnfpmmvpcwmfpmaialgntfilkpsertp llteklvelfekaglpkgvfnvvygahdvvngilehpeikaisfvgskpvgeyvykkgse nlkrvqsltgaknhtivlndanledtvtnivgaafgsagercmacavvtveegiadefma klqekvadikignglddgvflgpvirednkkrtlsyiekgleegarlvcdgrenvsddgy fvgptifdnvttemtiwkdeifapvlsvirvknlkeaieianksefangaclftsnsnai ryfrenidagmlginlgvpapmaffpfsgwkssffgtlhangkdsvdfytrkkvvtaryp apdf
Timeline for d1t90c_: