Lineage for d1svzb2 (1svz B:128-247)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352672Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2353425Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (34 PDB entries)
    Uniprot P06327 20-117 # HV52_MOUSE (P06327) Ig heavy chain V region VH558 A1/A4 precursor; 57% sequence identity ! Uniprot P01631 # KV2G_MOUSE (P01631) Ig kappa chain V-II region 26-10
  8. 2353428Domain d1svzb2: 1svz B:128-247 [202911]
    Other proteins in same PDB: d1svza1, d1svzb1
    automated match to d1jp5a2

Details for d1svzb2

PDB Entry: 1svz (more details), 1.89 Å

PDB Description: Crystal structure of the single-chain Fv fragment 1696 in complex with the epitope peptide corresponding to N-terminus of HIV-2 protease
PDB Compounds: (B:) single-chain Fv fragment 1696

SCOPe Domain Sequences for d1svzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svzb2 b.1.1.1 (B:128-247) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
evqlqqsgpelkkpgetvkisckatnyaftdysmhwvkqapggdlkyvgwintetdeptf
addfkgrfafsldtststaflqinnlknedtatyfcvrdrhdygeiftywgqgttvtvss

SCOPe Domain Coordinates for d1svzb2:

Click to download the PDB-style file with coordinates for d1svzb2.
(The format of our PDB-style files is described here.)

Timeline for d1svzb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1svzb1