Lineage for d1oakh1 (1oak H:215-336)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287195Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287615Species Mouse (Mus musculus), cluster 5 [TaxId:10090] [88555] (31 PDB entries)
  8. 287637Domain d1oakh1: 1oak H:215-336 [20291]
    Other proteins in same PDB: d1oaka_, d1oakh2, d1oakl1, d1oakl2
    part of Fab NMC-4 blocking the von willebrand factor (vwf) a1 domain function

Details for d1oakh1

PDB Entry: 1oak (more details), 2.2 Å

PDB Description: crystal structure of the von willebrand factor (vwf) a1 domain in complex with the function blocking nmc-4 fab

SCOP Domain Sequences for d1oakh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oakh1 b.1.1.1 (H:215-336) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5}
qvqlaesgpglvapsqslsitctvsgfsltdygvdwvrqppgkglewlgmiwgdgstdyn
salksrlsitkdnsksqvflkmnslqtddtaryycvrdpadygnydyaldywgqgtsvtv
ss

SCOP Domain Coordinates for d1oakh1:

Click to download the PDB-style file with coordinates for d1oakh1.
(The format of our PDB-style files is described here.)

Timeline for d1oakh1: