SCOPe 2.04: Domain d1suja2: 1suj A:174-374

Lineage for d1suja2 (1suj A:174-374)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (39 species)
   not a true protein

7. Species Ambystoma tigrinum [TaxId:8305] [225004] (1 PDB entry)

8. Domain d1suja2: 1suj A:174-374 [202907]
   automated match to d1cf1b2

Details for d1suja2

PDB Entry: 1suj, 2.38 Å

PDB Description: X-ray crystal structure of ambystoma tigrinum cone arrestin

PDB Compounds: (A:) cone arrestin

SCOPe Domain Sequences for d1suja2:

Sequence, based on SEQRES records:

>d1suja2 b.1.18.0 (A:174-374) automated matches {Ambystoma tigrinum [TaxId: 8305]}
nlgvapkteitrqfmlsdrplhleasldkeiyyhgepinvnvkinnttgkivkkikiive
qvtdvvlfsldkyvktvcaeetndtvaanstlsktfsvtpmlannrekrglaldgklkhe
dtnlasttvirpgmdkevlgilvsykvkvhlvvarggilgdltssdvavelpltlmhpkp
sddkprseediiieefarqkl

Sequence, based on observed residues (ATOM records):

>d1suja2 b.1.18.0 (A:174-374) automated matches {Ambystoma tigrinum [TaxId: 8305]}
nlgvapkteitrqfmlsdrplhleasldkeiyyhgepinvnvkinnttgkivkkikiive
qvtdvvlfsldkyvktvcaeetndtvaanstlsktfsvtpmlannrekrglaldgklkhe
dtnlasttvirpgmdkevlgilvsykvkvhlvvarggilgdltssdvavelpltlmhpkp
sddiiieefarqkl

Timeline for d1suja2:

• d1suja2 first appeared in SCOPe 2.03
  
• d1suja2 appears in SCOPe 2.05
  
• d1suja2 appears in the current release, SCOPe 2.08