Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (55 species) not a true protein |
Species Ambystoma tigrinum [TaxId:8305] [225004] (1 PDB entry) |
Domain d1suja1: 1suj A:5-173 [202906] automated match to d1cf1b1 |
PDB Entry: 1suj (more details), 2.38 Å
SCOPe Domain Sequences for d1suja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1suja1 b.1.18.0 (A:5-173) automated matches {Ambystoma tigrinum [TaxId: 8305]} skvykktcpnaklsiylgkrdfvdhvehvepvdgvvlidpeylkdrkvfvtltcafrygr ddldligmsfrkdlyslatqvyppetkepltplqeklmkklgahaypfcfkmgtnlpcsv tlqpgpddtgkscgvdfevkafcaenleekihkrnsvqlvirkvqfapa
Timeline for d1suja1: