SCOP 1.59: Domain d1oakl1: 1oak L:1-107

Lineage for d1oakl1 (1oak L:1-107)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Fab NMC-4 (mouse), kappa L chain [48860] (2 PDB entries)

8. Domain d1oakl1: 1oak L:1-107 [20290]
   Other proteins in same PDB: d1oaka_, d1oakh2, d1oakl2

Details for d1oakl1

PDB Entry: 1oak, 2.2 Å

PDB Description: crystal structure of the von willebrand factor (vwf) a1 domain in complex with the function blocking nmc-4 fab

SCOP Domain Sequences for d1oakl1:

Sequence; same for both SEQRES and ATOM records:

>d1oakl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab NMC-4 (mouse), kappa L chain}
diqmtqspsslsaslgdrvtiscsasqdinkylnwyqqkpdgavkllifytsslhsgvps
rfsgsgsgtdysltisnlepediatyycqqyeklpwtfgggtklevk

Timeline for d1oakl1:

• d1oakl1 first appeared (with stable ids) in SCOP 1.55
  
• d1oakl1 appears in SCOP 1.57
  
• d1oakl1 appears in SCOP 1.61
  
• d1oakl1 appears in the current release, SCOPe 2.08