Lineage for d1smke2 (1smk E:189-356)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2233134Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2233135Protein automated matches [226850] (29 species)
    not a true protein
  7. 2233195Species Citrullus lanatus [TaxId:3654] [224959] (2 PDB entries)
  8. 2233200Domain d1smke2: 1smk E:189-356 [202899]
    Other proteins in same PDB: d1smka1, d1smkb1, d1smkc1, d1smkd1, d1smke1, d1smkf1, d1smkg1, d1smkh1
    automated match to d1mlda2
    complexed with cit

Details for d1smke2

PDB Entry: 1smk (more details), 2.5 Å

PDB Description: Mature and translocatable forms of glyoxysomal malate dehydrogenase have different activities and stabilities but similar crystal structures
PDB Compounds: (E:) Malate dehydrogenase, glyoxysomal

SCOPe Domain Sequences for d1smke2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smke2 d.162.1.0 (E:189-356) automated matches {Citrullus lanatus [TaxId: 3654]}
vtmldvvrantfvaevlgldprdvdvpvvgghagvtilpllsqvkppssftqeeisyltd
riqnggtevveakagagsatlsmayaavkfadaclrglrgdagviecafvssqvtelpff
askvrlgrngieevyslgplneyeriglekakkelagsiekgvsfirs

SCOPe Domain Coordinates for d1smke2:

Click to download the PDB-style file with coordinates for d1smke2.
(The format of our PDB-style files is described here.)

Timeline for d1smke2: