Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (24 species) not a true protein |
Species Citrullus lanatus [TaxId:3654] [224959] (2 PDB entries) |
Domain d1seva2: 1sev A:189-356 [202887] Other proteins in same PDB: d1seva1, d1sevb1 automated match to d1mlda2 |
PDB Entry: 1sev (more details), 2.55 Å
SCOPe Domain Sequences for d1seva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1seva2 d.162.1.0 (A:189-356) automated matches {Citrullus lanatus [TaxId: 3654]} vtmldvvrantfvaevlgldprdvdvpvvgghagvtilpllsqvkppssftqeeisyltd riqnggtevveakagagsatlsmayaavkfadaclrglrgdagviecafvssqvtelpff askvrlgrngieevyslgplneyeriglekakkelagsiekgvsfirs
Timeline for d1seva2: