SCOP 1.69: Domain d1fnsl1: 1fns L:1-107

Lineage for d1fnsl1 (1fns L:1-107)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (162 PDB entries)

8. Domain d1fnsl1: 1fns L:1-107 [20288]
   Other proteins in same PDB: d1fnsa_, d1fnsh1, d1fnsh2, d1fnsl2
   part of Fab NMC-4 blocking the von willebrand factor (vwf) a1 domain function

Details for d1fnsl1

PDB Entry: 1fns, 2 Å

PDB Description: crystal structure of the von willebrand factor (vwf) a1 domain i546v mutant in complex with the function blocking fab nmc4

SCOP Domain Sequences for d1fnsl1:

Sequence; same for both SEQRES and ATOM records:

>d1fnsl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
diqmtqspsslsaslgdrvtiscsasqdinkylnwyqqkpdgavkllifytsslhsgvps
rfsgsgsgtdysltisnlepediatyycqqyeklpwtfgggtklevk

Timeline for d1fnsl1:

• d1fnsl1 first appeared (with stable ids) in SCOP 1.55
  
• d1fnsl1 appears in SCOP 1.67
  
• d1fnsl1 appears in SCOP 1.71
  
• d1fnsl1 appears in the current release, SCOPe 2.08